Сайт trends.builtwith.com

Технический анализ страниц сайта trends.builtwith.com

от 20.07.2021 12:29:10

Основные данные по сайту

Это ваш сайт?
Попробуйте наш сервис улучшения поведенческих факторов сайта и конверсии виджетами PFKA
Заголовок сайта
BuiltWith Web Technology Usage Statisticsfr
Наличие файла robots
есть
Веб архив
посмотреть
Изображения с сайта, известные Яндексу
посмотреть

Категории сайта

По данным VirusTotal

Данные по домену

Зарегистрирован с
22.07.2007
Зарегистрирован до
22.07.2027
Возраст (дней)
5 120
Осталось (дней)
2185
NS
Регистратор
NAMECHEAP INC
Родственные домены (sibling domain)
Поддомены

Сетевая информация

 по главной странице
Код ответа сервера

200

Число перенаправлений
0
IP адрес и порт получателя последнего соединения
149.56.238.61:443
Полное время загрузки
Время разрешения имени сервера (DNS time)
Время установки соединения
Время до готовности к фактической передаче данных
Время до момента передачи первого байта данных (TTFB)
Время на перенаправления
0 сек.
Вес страницы
226.41 KB
Средняя скорость загрузки
1.925 mbps

Данные по серверу

IPv4
149.56.238.61
Имя Internet-хоста
ip61.ip-149-56-238.net
Местоположение
Датацентр
OVH SAS
Домены, разрешенные для IP-адреса этого сайта
IP-адреса, на которых расположен этот сайт

Информация из Яндекс

 
тИЦ
ИКС

380

Данные из Web Of Trust

 
Заслуживает доверие
Безопасность для детей
Категория

Данные по SSL сертификату

Кому выдано

Общее имя (CN)
trends.builtwith.com
Организация (O)
Подразделение (OU)
Серийный номер
041196B7BCF03FC0F32E75DE8883EEDBED2C

Кем выдано

Общее имя (CN)
R3
Организация (O)
Let's Encrypt
Подразделение (OU)

Срок действия

Действителен с
25.06.2021
Действителен до
23.09.2021
Осталось (дней)
57

Отпечатки

Алгоритм подписания сертификата
RSA-SHA256

Прочее

Версия
3
Домены
trends.builtwith.com
Основные ограничения сертификата
Не является центром сертификации
Использование сертификата ключа
Digital Signature
Key Encipherment
Адреса распространения CRL
Политики сертификата
Policy: 2.23.140.1.2.1
Policy: 1.3.6.1.4.1.44947.1.1.1
CPS: http://cps.letsencrypt.org

Расширенное использование ключа
TLS Web Server Authentication
TLS Web Client Authentication
Идентификатор ключа центра сертификации
keyid:14:2E:B3:17:B7:58:56:CB:AE:50:09:40:E6:1F:AF:9D:8B:14:C2:C6
Доступ к информации о центре
OCSP - URI:http://r3.o.lencr.org
CA Issuers - URI:http://r3.i.lencr.org/

Список технологий на сайте

Font Scripts

Google Font API Google Font API

Web Servers

IIS (v.10.0) IIS (v.10.0)

Operating Systems

Windows Server Windows Server

JavaScript Frameworks

Mustache (v.2.3.0) Mustache (v.2.3.0)
Mustache Mustache

Web Frameworks

Bootstrap (v.4.3.1) Bootstrap (v.4.3.1)
Microsoft ASP.NET Microsoft ASP.NET

Данные по безопасности

  по версии Webutation

Проверка на вирусы

Дата проверки
20.07.2021 12:29:11
CMC Threat Intelligence
Не найдено
Snort IP sample list
Не найдено
VX Vault
Не найдено
Armis
Не найдено
Comodo Valkyrie Verdict
Не найдено
PhishLabs
K7AntiVirus
Не найдено
CINS Army
Не найдено
Cyren
Не найдено
Quttera
Не найдено
BlockList
Не найдено
OpenPhish
Не найдено
0xSI_f33d
Feodo Tracker
Не найдено
Web Security Guard
Не найдено
Scantitan
Не найдено
AlienVault
Не найдено
Sophos
Не найдено
Phishtank
Не найдено
EonScope
Не найдено
Cyan
Spam404
Не найдено
SecureBrain
Не найдено
Hoplite Industries
Не найдено
CRDF
Не найдено
Rising
Не найдено
Fortinet
Не найдено
alphaMountain.ai
Не найдено
Lionic
Не найдено
Virusdie External Site Scan
Не найдено
Artists Against 419
Не найдено
Google Safebrowsing
Не найдено
SafeToOpen
ADMINUSLabs
Не найдено
CyberCrime
Не найдено
AutoShun
Trustwave
Не найдено
AICC (MONITORAPP)
Не найдено
CyRadar
Не найдено
Dr.Web
Не найдено
Emsisoft
Не найдено
Abusix
Не найдено
Webroot
Не найдено
Avira
Не найдено
securolytics
Не найдено
Antiy-AVL
Не найдено
Quick Heal
Не найдено
DNS8
Не найдено
benkow.cc
Не найдено
EmergingThreats
Не найдено
Yandex Safebrowsing
Не найдено
MalwareDomainList
Не найдено
Lumu
zvelo
Не найдено
Kaspersky
Не найдено
Sucuri SiteCheck
Не найдено
desenmascara.me
Не найдено
URLhaus
Не найдено
PREBYTES
Не найдено
StopForumSpam
Не найдено
Blueliv
Не найдено
Netcraft
ZeroCERT
Не найдено
Phishing Database
Не найдено
MalwarePatrol
Не найдено
MalBeacon
Не найдено
Sangfor
Не найдено
IPsum
Не найдено
Spamhaus
Не найдено
Malwared
Не найдено
BitDefender
Не найдено
GreenSnow
Не найдено
G-Data
Не найдено
StopBadware
SCUMWARE.org
Не найдено
malwares.com URL checker
Не найдено
NotMining
Forcepoint ThreatSeeker
Не найдено
Certego
Не найдено
ESET
Не найдено
Threatsourcing
Не найдено
MalSilo
Не найдено
Nucleon
Не найдено
BADWARE.INFO
Не найдено
ThreatHive
Не найдено
FraudScore
Не найдено
Tencent
Не найдено
Bfore.Ai PreCrime
Не найдено
Baidu-International
Не найдено

Список проверенных страниц

Заголовок страницы
Вес
H1
H2
H3
H4
H5
H6
Moz PA
Moz rank

BuiltWith Web Technology Usage Statisticsfr

226.41 KB
1
1
0
32
5
0

Joomla! Usage StatisticsTrafficDownload NowAwardsfrusderuitplnlchgbbresgratczhuauuacazabedkirmxroarseptskDotCointrclnobyhrkzrsidvnfisinzmyltthbgtwilcnlvieeckepeeejphksgmenguyphbalumkisnutvlkmduzmagtbdtzdzbocrveaepkgetnegcysanpkgccpyzwlireazamalmlmzugtvpasvjoprtjnacmghafmnlbmtwssnqacietbsnihnkhbmmuaogpjmbfbwpsmcncsdkryezmmwbivcttbzmmmrpwbhaskwfjiqdmmgagfocdfmpgcuadrwsctopfsrshimbjsthtvugimqomglsbkymvsybbgdtgggsmsokinegytlvislbtawgmgnbndjtcytszlrlsjemstmcxlcnfkngfsxfkcwtdmpckgspmguwf

1.79 MB
1
1
0
0
4
0

Marketing Automation Usage Distribution in the Top 1 Million SitesfrusgbaubrdecarunlesitDotCojpplinvnmxseczbechdkcnzanztvclaruafinohuroatptsgkriehkidtrilskphmymeltgrirpengtwaethsibgecpkcctvkeeemlhrbyrskzshlvnuluuymasabdiscrmtlkgtpwprregepypamnvezwmkegcytnboamalggmdaztzsvbavcnpmugpqaliuztomqugfmhnwsdzbzghbsciagkwniafviomsnbmaomzttimkylbrwsocmnajmpsmcjobwkgcxmvkhbhgfmmstzmasadscfomsbbgihtjemgtjncgspmlccdiqbjfjgusdettmbnbtglgyawbilsslsrbfgdpfsxtcvudmgmmwsmwf

1.68 MB
1
2
0
0
2
0

Marketing Automation Usage Distribution in EgyptfrusgbaubrdecarunlesitDotCojpplinvnmxseczbechdkcnzanztvclaruafinohuroatptsgkriehkidtrilskphmymeltgrirpengtwaethsibgecpkcctvkeeemlhrbyrskzshlvnuluuymasabdiscrmtlkgtpwprregepypamnvezwmkegcytnboamalggmdaztzsvbavcnpmugpqaliuztomqugfmhnwsdzbzghbsciagkwniafviomsnbmaomzttimkylbrwsocmnajmpsmcjobwkgcxmvkhbhgfmmstzmasadscfomsbbgihtjemgtjncgspmlccdiqbjfjgusdettmbnbtglgyawbilsslsrbfgdpfsxtcvudmgmmwsmwf

1.68 MB
1
2
0
0
2
0

Websites using Omniture Adobe Test and TargetgbusaudecaOld TimeMoneyuserTrafficNew TimeHourglassfrusgbcaauitdeinchevron-downchevron-upquote-leftFirequote-rightDownload Nowlinkedin-inuserenvelopephone-volumeglobebuildingchart-lineth-listchart-piefilterfile-excelstopwatchNew TimeHigher Spendinginstagramfacebookyoutubegooglepinteresthubgitlinkedinmieovimtwittervk

292.80 KB
1
3
0
2
28
0

Fraud Prevention Usage Distribution in the Top 1 Million SitesfrusgbbrcaaurukrdeitnlesinmeDotCobezajpsesgmxchilnzplrocniedkathktrhunofiaridptgruaphczcltvtwskaetvltmymlvnlubgthngmtlvpebyccrssikzpkcrkeeehrecisuynuprscbdwspwmasagtpagglkvenptoqagemkegcymupyalbabmbomdnatzagghirimomazambshnshugbzlimctnzmzwvckwnivi

1.11 MB
1
2
0
0
2
0

Call Tracking Usage Distribution in the Top 1 Million SitesfrusruaugbcadeilnluaplbresnzitdkbyinkzcnsemxchzaDotCosgbephrojparatietrptgrhulumevncctvhknuczskmlnomytwaeclkrthfiidltmduztvbgpkbzrskgshnglvsikecrhrpweepebdamsaazmtpreggtuylkpageviir

865.38 KB
1
2
0
0
2
0

SSL providers Web Usage DistributioncausdegbrujpfrnlinauitcnesbrplchDotCozatvkrvnirczseattridbeuamxartwdkgrhumerofihknothptnzphclsgtvieilskmyccpkbyaengbgpekzazbdltrshrsasilveelutoegislkmakenpecuzpwmlgemkvegguyfmtnmtmdnuamcrqawsdzimbaaoafkwalcyshmnpagtpytzlibobzjolbugprghomcmrekgkhtmvczwpsmuiqstbhrwcuetbscxmzsvscsomcnittaghnnammsdgitjvibmsnjmcimvglbwmszmbbsycdpmpgmghtasfobtadkybffjtclcyencgpmwsxgdgsvagymovgpfdjsrbnsmmrtldmytvugmawnflytgbicwknmqgugnjebjlsnesbszwfgfmpslhmckaqgakifkpntdlrlaaxgwkmum

1.83 MB
1
2
0
0
2
0

SSL providers Web Usage Distribution unknownfrusdegbrujpnlcainauitcnesbrplchDotCozatvkrvnirczseattridbeuamxartwdkgrhumerofihknothptnzphclsgtvieilskmyccpkbyaengbgpekzazbdltrshrsasilveelutoegislkmakenpecuzpwmlgemkvegguyfmtnmtmdnuamcrqawsdzimbaaoafkwalcyshmnpagtpytzlibobzjolbugprghomcmrekgkhtmvczwpsmuiqstbhrwcuetbscxmzsvscsomcnittaghnnammsdgitjvibmsnjmcimvglbwmszmbbsycdpmpgmghtasfobtadkybffjtclcyencgpmwsxgdgsvagymovgpfdjsrbnsmmrtldmytvugmawnflytgbicwknmqgugnjebjlsnesbszwfgfmpslhmckaqgakifkpntdlrlaaxgwkmum

1.83 MB
1
2
0
0
2
0

Marketing Automation Usage Distribution in AngolafrusgbaubrdecarunlesitDotCojpplinvnmxseczbechdkcnzanztvclaruafinohuroatptsgkriehkidtrilskphmymeltgrirpengtwaethsibgecpkcctvkeeemlhrbyrskzshlvnuluuymasabdiscrmtlkgtpwprregepypamnvezwmkegcytnboamalggmdaztzsvbavcnpmugpqaliuztomqugfmhnwsdzbzghbsciagkwniafviomsnbmaomzttimkylbrwsocmnajmpsmcjobwkgcxmvkhbhgfmmstzmasadscfomsbbgihtjemgtjncgspmlccdiqbjfjgusdettmbnbtglgyawbilsslsrbfgdpfsxtcvudmgmmwsmwf

1.68 MB
1
2
0
0
2
0

Список заголовков H1-H6

Заголовки H1

Web Technology Usage Trends

Заголовки H2

Web and Internet Technology Usage Statistics

Заголовки H3

Заголовки H4

Advertising

Analytics and Tracking

Audio / Video Media

Content Delivery Network

Content Management System

Copyright

Document Encoding

Document Standards

Domain Parking

eCommerce

Email Hosting Providers

Frameworks

JavaScript Libraries and Functions

Language

Mapping

Mobile

Name Server

Operating Systems and Servers

Payment

Robots.txt

SEO Header Tag

SEO Meta Tag

SEO Title Tag

Shipping Providers

SSL Certificates

Syndication Techniques

Verified CDN

Verified Link

Web Hosting Providers

Web Master Registration

Web Servers

Widgets

Заголовки H5

BuiltWith Trends in France

Technology Groups

Public Companies

Curated Reports

Popular Technologies

Заголовки H6

Список заголовков HTTP

Заголовок
Значение

cache-control

private

content-type

text/html; charset=utf-8

content-encoding

gzip

vary

Accept-Encoding

server

Microsoft-IIS/10.0

cross-origin-opener-policy

same-origin

cross-origin-embedder-policy

require-corp

x-ua-compatible

IE=Edge,chrome=1

cross-origin-resource-policy

same-site

strict-transport-security

max-age=31536000; includeSubDomains; preload

date

Tue, 20 Jul 2021 09:29:12 GMT

connection

close

content-length

56476

Информация из Moz

Domain Authority
Page Authority
Rank
Дата

Информация из LinkPad

 
Дата последнего обновления

03.01.2021

Проиндексировано страниц

0

Количество зеркал домена

0

Количество доменов на том же IP

0

Количество найденных анкоров

1 893

Количество исходящих анкоров

0

Количество ссылающихся IP адресов

2 006

Количество ссылающихся подсетей

1 786

Сумма din доноров домена

7 077 421

Сумма dout всех доноров домена

4 803 152

iGood

1.473

Количество доменов, на которые ссылается сайт

0

Количество ссылок на сайт

8 805 ссылок на 2287 доменах

- с главных страниц

98 ссылок на 96 доменах

- со страниц 2-го УВ

1 797 ссылка на 1040 доменах

- со страниц 3-го УВ

6 195 ссылок на 1316 доменах

- со страниц 4-го УВ

715 ссылок на 149 доменах

Количество исходящих ссылок с сайта

0

- с главной страницы

0

- со страниц 2-го УВ

0

- на страницах 3-го УВ

0

- на страницах 4-го УВ

0

Информация из Alexa

 
Global Rank

Информация из LiveInternet

 
Просмотров за месяц
Посетителей за месяц
Просмотров за неделю
Посетителей за неделю
Просмотров за сутки
Посетителей за сутки
Просмотров сегодня
Посетителей сегодня

Информация из Google

PageSpeed общий балл
Изображения с сайта, известные Google
посмотреть

Информация из DomCop

Open PageRank
5
Open Rank
2 310

Информация из Webfinery

Visit Rank

Информация из DNSBL

Проверка наличия IP 149.56.238.61 в списках DNSBL

Внимание, IP обнаружен в некоторых DNSBL. Количество DNSBL, в которых обнаружен IP: 3

all.s5h.net
Не найдено
b.barracudacentral.org
Не найдено
bl.emailbasura.org
В Black List
bl.spamcannibal.org
Не найдено
bl.spamcop.net
Не найдено
blacklist.woody.ch
Не найдено
bogons.cymru.com
Не найдено
cbl.abuseat.org
Не найдено
cdl.anti-spam.org.cn
Не найдено
combined.abuse.ch
Не найдено
db.wpbl.info
Не найдено
dnsbl-1.uceprotect.net
Не найдено
dnsbl-2.uceprotect.net
Не найдено
dnsbl-3.uceprotect.net
В Black List
dnsbl.anticaptcha.net
Не найдено
dnsbl.cyberlogic.net
Не найдено
dnsbl.dronebl.org
Не найдено
dnsbl.inps.de
Не найдено
dnsbl.sorbs.net
Не найдено
dnsbl.spfbl.net
В Black List
drone.abuse.ch
Не найдено
duinv.aupads.org
Не найдено
dul.dnsbl.sorbs.net
Не найдено
dyna.spamrats.com
Не найдено
dynip.rothen.com
Не найдено
exitnodes.tor.dnsbl.sectoor.de
Не найдено
http.dnsbl.sorbs.net
Не найдено
ips.backscatterer.org
Не найдено
ix.dnsbl.manitu.net
Не найдено
korea.services.net
Не найдено
misc.dnsbl.sorbs.net
Не найдено
noptr.spamrats.com
Не найдено
orvedb.aupads.org
Не найдено
pbl.spamhaus.org
Не найдено
proxy.bl.gweep.ca
Не найдено
psbl.surriel.com
Не найдено
relays.bl.gweep.ca
Не найдено
relays.nether.net
Не найдено
sbl.spamhaus.org
Не найдено
short.rbl.jp
Не найдено
singular.ttk.pte.hu
Не найдено
smtp.dnsbl.sorbs.net
Не найдено
socks.dnsbl.sorbs.net
Не найдено
spam.abuse.ch
Не найдено
spam.dnsbl.anonmails.de
Не найдено
spam.dnsbl.sorbs.net
Не найдено
spam.spamrats.com
Не найдено
spambot.bls.digibase.ca
Не найдено
spamrbl.imp.ch
Не найдено
spamsources.fabel.dk
Не найдено
ubl.lashback.com
Не найдено
ubl.unsubscore.com
Не найдено
virus.rbl.jp
Не найдено
web.dnsbl.sorbs.net
Не найдено
wormrbl.imp.ch
Не найдено
xbl.spamhaus.org
Не найдено
z.mailspike.net
Не найдено
zen.spamhaus.org
Не найдено
zombie.dnsbl.sorbs.net
Не найдено

Список мета-тегов

name/property
Значение

http-equiv: x-ua-compatible

ie=edge

name: description

Web Technology usage statistics and list of websites using web technologies.

name: viewport

width=device-width, initial-scale=1, shrink-to-fit=no

name: theme-color

#ffffff

name: description

Web Technology usage statistics and list of websites using web technologies.

Список изображений

URL
alt
HTTP code

Список иконок

Тип
URL

mask-icon

apple-touch-icon

icon

История проверок сайта

20.07.2021 12:29:10

Скриншот сайта

Сервис улучшения поведенческих факторов сайта и конверсии виджетами. Попробуйте инструмент PFKA

Продвигаете с Sape? Попробуйте инструмент "Работа с Sape".

Попробуйте для мониторинга своих сайтов и доменов инструмент "Мои сайты".

Вступайте в нашу группу Вконтакте
Оставить отзыв, задать вопрос, написать идею или сообщить о проблеме можно здесь: feedback.linkonavt.ru